Total number of results for Arthurdendyus triangulatus are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP01573 |
RYIRF
|
5 | Arthurdendyus triangulatus | FMRFamide related peptide | FMRFamide-like neuropeptide RYIRF-amide | 7909164#Maule A.G., Shaw C., Halton D.W., Curry W.J., Thim L.; #RYIRFamide: a turbellarian FMRFamide-related peptide (FaRP).; #Regul. Pept. 50:37-43(1994). | |
| NP03856 |
KVVHLRPRSSFSSEDEYQIYLRNVSKYIQLYGRPRF
|
36 | Arthurdendyus triangulatus | NPY | Neuropeptide F | 1354101#Curry W.J., Shaw C., Johnston C.F., Thim L., Buchanan K.D.; #Neuropeptide F: primary structure from the tubellarian, Artioposthia triangulata.; #Comp. Biochem. Physiol. 101C:269-274(1992). |